GPHA2, Human (HEK293, His)
GPHA2 acts as a heterodimeric glycoprotein hormone together with GPHB5 to form a complex that binds and activates the thyroid-stimulating hormone receptor (TSHR), thereby triggering elevated cAMP production. This protein complex plays a key role in the regulation of thyroid cell metabolism, controlling the basic metabolic processes of thyroid cells. GPHA2 Protein, Human (HEK293, His) is the recombinant human-derived GPHA2 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
GPHA2 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gpha2-protein-human-hek293-his.html
Purity
95.0
Smiles
QEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGHCESSAFPSRYSVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQCDMCRLSRY
Molecular Formula
170589 (Gene_ID) Q96T91 (Q24-Y129) (Accession)
Molecular Weight
Approximately 23 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL
CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL
CD19 (CVID3/155), CF555 conjugate, 0.1mg/mL
Cytokeratin 13 (Non-Keratinized Squamous Epithelial Marker) (KRT13/2213), CF568 conjugate, 0.1mg/mL
