Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Helospectin I

Helospectin I is a neuropeptide of the vasoactive intestinal peptide (VIP) family. Helospectin I has vasodilatory and antihypertensive activities, and decreases blood pressure. Helospectin I is originally isolated from the salivary gland venom of the lizard Heloderma suspectum.

Product Specifications

Purity

≥95%

Molecular Weight

4095.66

Notes

For research use only.

AA Sequence

HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Breast, right
CS650307 5x 5 µm

Frozen Tissue Sections, Breast, right

Sign In for Pricing
View Details
Human RPP40 activation kit by CRISPRa
GA107400 1 Kit

Human RPP40 activation kit by CRISPRa

Sign In for Pricing
View Details
TNKS2 siRNA (Human)
CRJ2875-01 15 nmol

TNKS2 siRNA (Human)

Sign In for Pricing
View Details
TNKS2 siRNA (Human)
CRJ2875-02 30 nmol

TNKS2 siRNA (Human)

Sign In for Pricing
View Details
PLV3-U6-GOLPH3-shRNA2-Puro Plasmid
PVT82219 2 µg

PLV3-U6-GOLPH3-shRNA2-Puro Plasmid

Sign In for Pricing
View Details
Mouse SNTN siRNA
abx934577-01 15 nmol

Mouse SNTN siRNA

Sign In for Pricing
View Details