Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Helospectin I

Helospectin I is a neuropeptide of the vasoactive intestinal peptide (VIP) family. Helospectin I has vasodilatory and antihypertensive activities, and decreases blood pressure. Helospectin I is originally isolated from the salivary gland venom of the lizard Heloderma suspectum.

Product Specifications

Purity

≥95%

Molecular Weight

4095.66

Notes

For research use only.

AA Sequence

HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAF1D, NT (TAF1D, JOSD3, TATA box-binding protein-associated factor RNA polymerase I subunit D, RNA polymerase I-specific TBP-associated factor 41kD, TATA box-binding protein-associated factor 1D, Transcription initiation factor SL1/TIF-IB subunit D) (Max
MBS6353367-01 0.1 mL

TAF1D, NT (TAF1D, JOSD3, TATA box-binding protein-associated factor RNA polymerase I subunit D, RNA polymerase I-specific TBP-associated factor 41kD, TATA box-binding protein-associated factor 1D, Transcription initiation factor SL1/TIF-IB subunit D) (Max

Sign In for Pricing
View Details
TAF1D, NT (TAF1D, JOSD3, TATA box-binding protein-associated factor RNA polymerase I subunit D, RNA polymerase I-specific TBP-associated factor 41kD, TATA box-binding protein-associated factor 1D, Transcription initiation factor SL1/TIF-IB subunit D) (Max
MBS6353367-02 5x 0.1 mL

TAF1D, NT (TAF1D, JOSD3, TATA box-binding protein-associated factor RNA polymerase I subunit D, RNA polymerase I-specific TBP-associated factor 41kD, TATA box-binding protein-associated factor 1D, Transcription initiation factor SL1/TIF-IB subunit D) (Max

Sign In for Pricing
View Details
RBPMS (Biotin)
574470-01 50 µg

RBPMS (Biotin)

Sign In for Pricing
View Details
RBPMS (Biotin)
574470-02 100 µg

RBPMS (Biotin)

Sign In for Pricing
View Details
IgG4 Mouse Monoclonal Antibody [Clone 4F5]
E45M21605V-2 50 µL

IgG4 Mouse Monoclonal Antibody [Clone 4F5]

Sign In for Pricing
View Details
POTB7-PRAS40
PPL00180 1 Each

POTB7-PRAS40

Sign In for Pricing
View Details