Helospectin I
Helospectin I is a neuropeptide of the vasoactive intestinal peptide (VIP) family. Helospectin I has vasodilatory and antihypertensive activities, and decreases blood pressure. Helospectin I is originally isolated from the salivary gland venom of the lizard Heloderma suspectum.
Product Specifications
Purity
≥95%
Molecular Weight
4095.66
Notes
For research use only.
AA Sequence
HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPSS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
NBP2-78817APC 0.1 mL
Rabbit Polyclonal ALKBH5 Antibody [Allophycocyanin]
Sign In for Pricing
View Details 
244740 25 Pack (1 Label (s) x 25 Card)
VOLTAGE MARKERS CV 380 VOLT A Conduit & Voltage Markers
Sign In for Pricing
View Details MBS4381144-01 0.02 mg (With BSA & Azide at 0.2mg/mL)
PAPP-A/Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus)
Sign In for Pricing
View Details MBS4381144-02 0.1 mg (With BSA & Azide at 0.2mg/mL)
PAPP-A/Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus)
Sign In for Pricing
View Details