Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP (3 - 42), human

GIP (3-42), human acts as a glucose-dependent insulinotropic polypeptide (GIP) receptor antagonist, moderating the insulin secreting and metabolic actions of GIP in vivo.

Product Specifications

Purity

≥95%

Solubility

Water: 50 mg/mL. DMSO: 100 mg/mL

Molecular Weight

4749.38

Notes

For research use only.

AA Sequence

EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-KLF5 (Ser311) Rabbit Polyclonal Antibody (APC)
orb994339 100 µL

Phospho-KLF5 (Ser311) Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Recombinant Peroxiredoxin 6 Rabbit mAb
E38MA4383 100 µL

Recombinant Peroxiredoxin 6 Rabbit mAb

Sign In for Pricing
View Details
Rabbit Polyclonal AMMECR1 Antibody [DyLight 488]
NBP2-97342G 0.1 mL

Rabbit Polyclonal AMMECR1 Antibody [DyLight 488]

Sign In for Pricing
View Details
Mouse Monoclonal SHBG Antibody (SHBG/245) [Alexa Fluor 405]
NBP2-48007AF405 0.1 mL

Mouse Monoclonal SHBG Antibody (SHBG/245) [Alexa Fluor 405]

Sign In for Pricing
View Details
Lipo1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3196005 3x 1.0 µg

Lipo1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
USP11 (Ubiquitin-specific Processing Protease 11, UHX1) (MaxLight 650)
MBS6442718-01 0.1 mL

USP11 (Ubiquitin-specific Processing Protease 11, UHX1) (MaxLight 650)

Sign In for Pricing
View Details