Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP (3 - 42), human

GIP (3-42), human acts as a glucose-dependent insulinotropic polypeptide (GIP) receptor antagonist, moderating the insulin secreting and metabolic actions of GIP in vivo.

Product Specifications

Purity

≥95%

Solubility

Water: 50 mg/mL. DMSO: 100 mg/mL

Molecular Weight

4749.38

Notes

For research use only.

AA Sequence

EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLT1 Antibody : Biotin (OAAF00856-Biotin)
OAAF00856-100UG-Biotin 100 µg

FLT1 Antibody : Biotin (OAAF00856-Biotin)

Sign In for Pricing
View Details
ADRB2 Antibody
orb689039-01 50 μL

ADRB2 Antibody

Sign In for Pricing
View Details
ADRB2 Antibody
orb689039-02 100 µL

ADRB2 Antibody

Sign In for Pricing
View Details
Classic 16 boxes 32mm, 572x140x140mm, w/locking rod, B10
TE21358B10 1 Piece

Classic 16 boxes 32mm, 572x140x140mm, w/locking rod, B10

Sign In for Pricing
View Details
Box of 200 Cyto-Centrifugal Filter, 26X76 Mm + 1 Centric Hole 7X7 Mm
CY430F2676_1T0707Q Box of 200

Box of 200 Cyto-Centrifugal Filter, 26X76 Mm + 1 Centric Hole 7X7 Mm

Sign In for Pricing
View Details
Rabbit Polyclonal Myozenin 1 Antibody
NBP3-03528-20ul 20 µL

Rabbit Polyclonal Myozenin 1 Antibody

Sign In for Pricing
View Details