Interleukin-6 fragment (human)
Interleukin-6 fragment (human) is a pleiotropic cytokine produced by lymphocytes and non-lymphocytes. The Interleukin-6 fragment (human) coding gene is located on human chromosome 7, with a length of approximately 5 kilobases. Interleukin-6 fragment (human) has potential applications in immune response, acute response, inflammation, tumors, and hematopoiesis.
Product Specifications
Field of Research
Immunology & Inflammation
Purity
≥95%
Molecular Weight
4023.57
Notes
For research use only.
AA Sequence
IITGLLEFEVYLEYLQNRFESSEEQARAVQMSTK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog