Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Interleukin-6 fragment (human)

Interleukin-6 fragment (human) is a pleiotropic cytokine produced by lymphocytes and non-lymphocytes. The Interleukin-6 fragment (human) coding gene is located on human chromosome 7, with a length of approximately 5 kilobases. Interleukin-6 fragment (human) has potential applications in immune response, acute response, inflammation, tumors, and hematopoiesis.

Product Specifications

Field of Research

Immunology & Inflammation

Purity

≥95%

Molecular Weight

4023.57

Notes

For research use only.

AA Sequence

IITGLLEFEVYLEYLQNRFESSEEQARAVQMSTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR11H2-set siRNA/shRNA/RNAi Lentivector (Human)
34930091 4x 500 ng

OR11H2-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
SH3GL1 Protein Lysate (Mouse) with C-HA Tag
43673034 100 µg

SH3GL1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Pmfbp1 AAV siRNA Pooled Vector
37063166 1.0 µg

Pmfbp1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
LU AA33810
3562/10 10 mg

LU AA33810

Sign In for Pricing
View Details
Human IL-12 p70 ELISA Kit
CEK1741 96 Tests

Human IL-12 p70 ELISA Kit

Sign In for Pricing
View Details
KPNA4 Polyclonal Antibody, PE-Cy5 Conjugated
bs-16804R-PE-Cy5 100 µL

KPNA4 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details