Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Interleukin-6 fragment (human)

Interleukin-6 fragment (human) is a pleiotropic cytokine produced by lymphocytes and non-lymphocytes. The Interleukin-6 fragment (human) coding gene is located on human chromosome 7, with a length of approximately 5 kilobases. Interleukin-6 fragment (human) has potential applications in immune response, acute response, inflammation, tumors, and hematopoiesis.

Product Specifications

Field of Research

Immunology & Inflammation

Purity

≥95%

Molecular Weight

4023.57

Notes

For research use only.

AA Sequence

IITGLLEFEVYLEYLQNRFESSEEQARAVQMSTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL
BNC040525-500 1x 500 µL

CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL
CD11c (HC1/1), CF680R conjugate, 0.1mg/mL
BNC810152-500 1x 500 µL

CD11c (HC1/1), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL
BNC680977-100 1x 100 µL

TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF647 conjugate, 0.1mg/mL
BNC471035-500 1x 500 µL

CD8 (C8/1035), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (KP1), CF405S conjugate, 0.1mg/mL
BNC040512-500 1x 500 µL

CD68 (KP1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details