Interleukin-6 fragment (human)
Interleukin-6 fragment (human) is a pleiotropic cytokine produced by lymphocytes and non-lymphocytes. The Interleukin-6 fragment (human) coding gene is located on human chromosome 7, with a length of approximately 5 kilobases. Interleukin-6 fragment (human) has potential applications in immune response, acute response, inflammation, tumors, and hematopoiesis.
Product Specifications
Field of Research
Immunology & Inflammation
Purity
≥95%
Molecular Weight
4023.57
Notes
For research use only.
AA Sequence
IITGLLEFEVYLEYLQNRFESSEEQARAVQMSTK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
129913-ML650 100 µL
MS4A7 (4SPAN2, CD20L4, CFFM4, Membrane-spanning 4-domains Subfamily A Member 7, CD20 Antigen-like 4, CD20/FC-epsilon-RI-beta Family Member 4, Four-span Transmembrane Protein 2, MGC22368, MS4A8) (MaxLight 650)
Sign In for Pricing
View Details ![[KO] EXOSC1 Mouse mAb](https://cdn.genprice.uk/genprice/uk/genprice3.webp)