Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, mouse, rat

GIP, mouse, rat

Product Specifications

Purity

≥95%

Molecular Weight

5002.69

Notes

For research use only.

AA Sequence

YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNITQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CACNB2 Conjugated Antibody
orb1620593 100 µL

CACNB2 Conjugated Antibody

Sign In for Pricing
View Details
Dengue Virus, pan, NS1 (DENV)
052521 1 mg

Dengue Virus, pan, NS1 (DENV)

Sign In for Pricing
View Details
SIRPA Antibody (Biotin)
orb350703-01 50 µg

SIRPA Antibody (Biotin)

Sign In for Pricing
View Details
SIRPA Antibody (Biotin)
orb350703-02 100 µg

SIRPA Antibody (Biotin)

Sign In for Pricing
View Details
BABAM2 Rabbit pAb
E47R5710 100 µL

BABAM2 Rabbit pAb

Sign In for Pricing
View Details
Anti-AHA1/AHSA1 Antibody Picoband® Fluoro647 Conjugated
A05733-2-Fluoro647 100 µg/Vial

Anti-AHA1/AHSA1 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details