Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, mouse, rat

GIP, mouse, rat

Product Specifications

Purity

≥95%

Molecular Weight

5002.69

Notes

For research use only.

AA Sequence

YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNITQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZCWPW2 Rabbit Polyclonal Antibody (HRP)
orb476642 100 µL

ZCWPW2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Mouse EHMT2 (Center) Rabbit pAb
MBS8557201-01 0.1 mL

Mouse EHMT2 (Center) Rabbit pAb

Sign In for Pricing
View Details
Mouse EHMT2 (Center) Rabbit pAb
MBS8557201-02 0.1 mL (AF405L)

Mouse EHMT2 (Center) Rabbit pAb

Sign In for Pricing
View Details
Mouse EHMT2 (Center) Rabbit pAb
MBS8557201-03 0.1 mL (AF405S)

Mouse EHMT2 (Center) Rabbit pAb

Sign In for Pricing
View Details
Mouse EHMT2 (Center) Rabbit pAb
MBS8557201-04 0.1 mL (AF610)

Mouse EHMT2 (Center) Rabbit pAb

Sign In for Pricing
View Details
Mouse EHMT2 (Center) Rabbit pAb
MBS8557201-05 0.1 mL (AF635)

Mouse EHMT2 (Center) Rabbit pAb

Sign In for Pricing
View Details