Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Big Endothelin -1 (1-39), porcine

Big Endothelin-1 (1-39), porcine is the precursor of endothelin-1. Endothelin-1 (ET-1) is a potent vasopressor peptide. Big Endothelin-1 (1-39), porcine has similar pressor effects in vivo.

Product Specifications

Field of Research

Epigenetics & Chromatin

Purity

≥95%

Molecular Weight

4370.7

Notes

For research use only.

AA Sequence

CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS (Disulfide bridge: Cys1-Cys15; Cys3-Cys11)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/1035), CF568 conjugate, 0.1mg/mL
BNC681035-500 1x 500 µL

CD8 (C8/1035), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF568 conjugate, 0.1mg/mL
BNC680012-100 1x 100 µL

Tyrosinase (T311), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (NAPSA/1865R), CF568 conjugate, 0.1mg/mL
BNC681865-100 1x 100 µL

Napsin A (Lung Adenocarcinoma Marker) (NAPSA/1865R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (K72.7), CF640R conjugate, 0.1mg/mL
BNC400757-500 1x 500 µL

Cytokeratin 7 (K72.7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (QBEnd/10), CF640R conjugate, 0.1mg/mL
BNC400640-100 1x 100 µL

CD34 (QBEnd/10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MCM7 (Proliferation Marker) (MCM7/1467), CF640R conjugate, 0.1mg/mL
BNC401467-100 1x 100 µL

MCM7 (Proliferation Marker) (MCM7/1467), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details