Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, porcine

Gastric Inhibitory Peptide, porcine is a glucose-dependent insulinotropic polypeptide, is a 42 amino acid intestinal hormone with effects on fat and glucose metabolism.

Product Specifications

Purity

≥95%

Solubility

DMSO: ≥ 33.33 mg/mL

Molecular Weight

4975.66

Notes

For research use only.

AA Sequence

YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H3FT (HIST3H3) Mouse Monoclonal Antibody [Clone ID: 4A1-9G8-3A9]
TA384419 100 µL

H3FT (HIST3H3) Mouse Monoclonal Antibody [Clone ID: 4A1-9G8-3A9]

Sign In for Pricing
View Details
Polystyrene AM COOH
H50056003.25G 25 g

Polystyrene AM COOH

Sign In for Pricing
View Details
Tissue FFPE Sections, Rectum
CS808717 5x 5 µm

Tissue FFPE Sections, Rectum

Sign In for Pricing
View Details
Human WRCH1 (RHOU) activation kit by CRISPRa
GA111766 1 Kit

Human WRCH1 (RHOU) activation kit by CRISPRa

Sign In for Pricing
View Details
CWF19L2 Human Gene Knockout Kit (CRISPR)
KN419488 1 Kit

CWF19L2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DDX55 Antibody
8C14658-AAT 50 µg

DDX55 Antibody

Sign In for Pricing
View Details