Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, porcine

Gastric Inhibitory Peptide, porcine is a glucose-dependent insulinotropic polypeptide, is a 42 amino acid intestinal hormone with effects on fat and glucose metabolism.

Product Specifications

Purity

≥95%

Solubility

DMSO: ≥ 33.33 mg/mL

Molecular Weight

4975.66

Notes

For research use only.

AA Sequence

YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thymosin beta 10 (TMSB10) (NM_021103) Human Over-expression Lysate
LC402833 20 µg

Thymosin beta 10 (TMSB10) (NM_021103) Human Over-expression Lysate

Sign In for Pricing
View Details
Lamin B Receptor / LBR Recombinant Rabbit monoclonal Antibody
HA750848 100 µL

Lamin B Receptor / LBR Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
APC Anti-Mouse CD24 Antibody[M1/69]
E-AB-F1179UE-01 25 µg

APC Anti-Mouse CD24 Antibody[M1/69]

Sign In for Pricing
View Details
APC Anti-Mouse CD24 Antibody[M1/69]
E-AB-F1179UE-02 100 µg

APC Anti-Mouse CD24 Antibody[M1/69]

Sign In for Pricing
View Details
Cy2DIGE NHS ester
25300-AAT 100 nmoles

Cy2DIGE NHS ester

Sign In for Pricing
View Details
Frozen Tissue Blocks, Colon: rectosigmoid
CB627326 1 Block

Frozen Tissue Blocks, Colon: rectosigmoid

Sign In for Pricing
View Details