Helodormin
Helodormin is a VIP-secretin-like peptide isolated from the venom of the Mexican monster lizard (Heloderma suspectum) . Helodormin affects a variety of cellular functions by modulating intracellular signaling through activation of adenylate cyclase. Helodormin can be used to study the evolution and function of the secretin and VIP peptide families。
Product Specifications
Purity
≥95%
Molecular Weight
3843.47
Notes
For research use only.
AA Sequence
HSDAIFTQQYSKLLAKLALQKYLASILGSRTSPPP-NH2
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
AF6004-SP 25 µg
Human/Mouse Cyclin B2 Affinity Purified Polyclonal Ab
Sign In for Pricing
View Details MBS454915-01 48 Tests
Human Colony Stimulating Factor Receptor, Granulocyte (GCSFR) ELISA Kit
Sign In for Pricing
View Details 
MBS454915-02 96 Tests
Human Colony Stimulating Factor Receptor, Granulocyte (GCSFR) ELISA Kit
Sign In for Pricing
View Details 
MBS454915-03 5x 96 Tests
Human Colony Stimulating Factor Receptor, Granulocyte (GCSFR) ELISA Kit
Sign In for Pricing
View Details MBS454915-04 10x 96 Tests
Human Colony Stimulating Factor Receptor, Granulocyte (GCSFR) ELISA Kit
Sign In for Pricing
View Details