Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Helodormin

Helodormin is a VIP-secretin-like peptide isolated from the venom of the Mexican monster lizard (Heloderma suspectum) . Helodormin affects a variety of cellular functions by modulating intracellular signaling through activation of adenylate cyclase. Helodormin can be used to study the evolution and function of the secretin and VIP peptide families。

Product Specifications

Purity

≥95%

Molecular Weight

3843.47

Notes

For research use only.

AA Sequence

HSDAIFTQQYSKLLAKLALQKYLASILGSRTSPPP-NH2

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Sus scrofa Platelet-derived growth factor subunit B
MBS9021906-01 0.02 mg (E-Coli)

Recombinant Sus scrofa Platelet-derived growth factor subunit B

Sign In for Pricing
View Details
Recombinant Sus scrofa Platelet-derived growth factor subunit B
MBS9021906-02 0.1 mg (E-Coli)

Recombinant Sus scrofa Platelet-derived growth factor subunit B

Sign In for Pricing
View Details
Recombinant Sus scrofa Platelet-derived growth factor subunit B
MBS9021906-03 1 mg (E-Coli)

Recombinant Sus scrofa Platelet-derived growth factor subunit B

Sign In for Pricing
View Details
Recombinant Sus scrofa Platelet-derived growth factor subunit B
MBS9021906-04 5x 1 mg (E-Coli)

Recombinant Sus scrofa Platelet-derived growth factor subunit B

Sign In for Pricing
View Details
Palmitic acid (Standard)
HY-N0830R-01 25 mg

Palmitic acid (Standard)

Sign In for Pricing
View Details
Palmitic acid (Standard)
HY-N0830R-02 50 mg

Palmitic acid (Standard)

Sign In for Pricing
View Details