(Pro3) Gastric Inhibitory Peptide (GIP), human
(Pro3) GIP, human ((Pro3) Gastric Inhibitory Peptide, human) is an efficacious, stable and specific human GIP receptor (hGIPR) full agonist. (Pro3) GIP, human has high binding affinity for human GIPR with Ki/ Kd values of 0.90 nM. (Pro3) GIP, human can be used for the research of obesity-related diabetes.
Product Specifications
Field of Research
Metabolism Research; Gastroenterology & Hepatology
Purity
≥95%
Molecular Weight
4951.53
Notes
For research use only.
AA Sequence
YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog