Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Thr30]-Neuropeptide Y, human

[Thr30]-Neuropeptide Y, human

Product Specifications

Purity

≥95%

Molecular Weight

4259.7

Notes

For research use only.

AA Sequence

YPSKPDNPGEDAPAEDMARYYSALRHYINTITRQRY-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diethyl 2-(4-Chlorobutyl)malonate
TRC-D187190-25G 25 g

Diethyl 2-(4-Chlorobutyl)malonate

Sign In for Pricing
View Details
Chicken Ciliary Neurotrophic Factor (CNTF) ELISA Kit
RDR-CNTF-Ch-01 96 Tests

Chicken Ciliary Neurotrophic Factor (CNTF) ELISA Kit

Sign In for Pricing
View Details
Chicken Ciliary Neurotrophic Factor (CNTF) ELISA Kit
RDR-CNTF-Ch-02 48 Tests

Chicken Ciliary Neurotrophic Factor (CNTF) ELISA Kit

Sign In for Pricing
View Details
Setd2 Mouse Gene Knockout Kit (CRISPR)
KN315625BN 1 Kit

Setd2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Monodocosahexaenoin
TRC-M539553-10MG 10 mg

Monodocosahexaenoin

Sign In for Pricing
View Details
Cyclin D1 (G1-Cyclin & Mantle Cell Lymphoma Marker) (CCND1/3548), CF740 conjugate, 0.1mg/mL
BNC743548-100 1x 100 µL

Cyclin D1 (G1-Cyclin & Mantle Cell Lymphoma Marker) (CCND1/3548), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details