Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Thr30]-Neuropeptide Y, human

[Thr30]-Neuropeptide Y, human

Product Specifications

Purity

≥95%

Molecular Weight

4259.7

Notes

For research use only.

AA Sequence

YPSKPDNPGEDAPAEDMARYYSALRHYINTITRQRY-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bckdk Mouse Gene Knockout Kit (CRISPR)
KN502092 1 Kit

Bckdk Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Twinkle (TWNK) (NM_001163812) Human Over-expression Lysate
LY431501 100 µg

Twinkle (TWNK) (NM_001163812) Human Over-expression Lysate

Sign In for Pricing
View Details
Uncoated Human MCSF (Macrophage Colony Stimulating Factor 1) ELISA Kit
E-UNEL-H0212-01 5x 96 Tests

Uncoated Human MCSF (Macrophage Colony Stimulating Factor 1) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human MCSF (Macrophage Colony Stimulating Factor 1) ELISA Kit
E-UNEL-H0212-02 15x 96 Tests

Uncoated Human MCSF (Macrophage Colony Stimulating Factor 1) ELISA Kit

Sign In for Pricing
View Details
Human C4orf44 (MSANTD1) activation kit by CRISPRa
GA117607 1 Kit

Human C4orf44 (MSANTD1) activation kit by CRISPRa

Sign In for Pricing
View Details
3-[[(5-Carboxypentyl)amino]carbonyl]-3-hydroxypentanedioic Acid
TRC-C181165-50MG 50 mg

3-[[(5-Carboxypentyl)amino]carbonyl]-3-hydroxypentanedioic Acid

Sign In for Pricing
View Details