Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Thr30]-Neuropeptide Y, human

[Thr30]-Neuropeptide Y, human

Product Specifications

Purity

≥95%

Molecular Weight

4259.7

Notes

For research use only.

AA Sequence

YPSKPDNPGEDAPAEDMARYYSALRHYINTITRQRY-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 Mouse Monoclonal Antibody [Clone ID: L17F12]
AM26700AC-N 100 Tests

CD5 Mouse Monoclonal Antibody [Clone ID: L17F12]

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), 0.2mg/mL
BNUB0225-100 1x 100 µL

Major Vault Protein (MVP) (1032), 0.2mg/mL

Sign In for Pricing
View Details
TIMP3 (Rabbit PAb), CF568 conjugate, 0.1mg/mL
BNC680408-500 1x 500 µL

TIMP3 (Rabbit PAb), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Rat PRL8A4 Protein (His Tag)
PKSR030153 100 µg

Recombinant Rat PRL8A4 Protein (His Tag)

Sign In for Pricing
View Details
Rad9a Mouse Gene Knockout Kit (CRISPR)
KN514424 1 Kit

Rad9a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ethylene Diamine
TRC-E917695-500ML 500 mL

Ethylene Diamine

Sign In for Pricing
View Details