Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Parathyroid Hormone (1-34), rat

Parathyroid hormone (1-34) (rat) is a parathyroid hormone. Parathyroid hormone (1-34) (rat) improves both cortical and cancellous bone structure. Parathyroid hormone (1-34) (rat) can be used for the research of osteoporosis.

Product Specifications

Field of Research

Metabolism Research

Purity

≥95%

Molecular Weight

4057.8

Notes

For research use only.

AA Sequence

AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NDRG2 activation kit by CRISPRa
GA111495 1 Kit

Human NDRG2 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Max Dimerization Protein 3 Antibody
RC-16009-01 50 μL

Recombinant Max Dimerization Protein 3 Antibody

Sign In for Pricing
View Details
Recombinant Max Dimerization Protein 3 Antibody
RC-16009-02 100 µL

Recombinant Max Dimerization Protein 3 Antibody

Sign In for Pricing
View Details
Recombinant Max Dimerization Protein 3 Antibody
RC-16009-03 1 mL

Recombinant Max Dimerization Protein 3 Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Ileum
CS624741 5x 5 µm

Frozen Tissue Sections, Ileum

Sign In for Pricing
View Details
SEC23B (NM_032986) Human Recombinant Protein
TP320880 20 µg

SEC23B (NM_032986) Human Recombinant Protein

Sign In for Pricing
View Details