Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Parathyroid Hormone (1-34), rat

Parathyroid hormone (1-34) (rat) is a parathyroid hormone. Parathyroid hormone (1-34) (rat) improves both cortical and cancellous bone structure. Parathyroid hormone (1-34) (rat) can be used for the research of osteoporosis.

Product Specifications

Field of Research

Metabolism Research

Purity

≥95%

Molecular Weight

4057.8

Notes

For research use only.

AA Sequence

AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Uterus
CB618345 1 Block

Frozen Tissue Blocks, Uterus

Sign In for Pricing
View Details
Cox15 Mouse Gene Knockout Kit (CRISPR)
KN503714 1 Kit

Cox15 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Diisoheptyl Phthalate (mixture of C7 isomers)
TRC-D455720-5ML 5 mL

Diisoheptyl Phthalate (mixture of C7 isomers)

Sign In for Pricing
View Details
PAICS Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B4]
TA501470AM 100 µL

PAICS Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B4]

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS628472 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
Human GGTLC1 activation kit by CRISPRa
GA114178 1 Kit

Human GGTLC1 activation kit by CRISPRa

Sign In for Pricing
View Details