Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Parathyroid Hormone (1-34), rat

Parathyroid hormone (1-34) (rat) is a parathyroid hormone. Parathyroid hormone (1-34) (rat) improves both cortical and cancellous bone structure. Parathyroid hormone (1-34) (rat) can be used for the research of osteoporosis.

Product Specifications

Field of Research

Metabolism Research

Purity

≥95%

Molecular Weight

4057.8

Notes

For research use only.

AA Sequence

AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,1-Dichloroethylene-d2
TRC-D434361-250MG 250 mg

1,1-Dichloroethylene-d2

Sign In for Pricing
View Details
KIST (UHMK1) Human Gene Knockout Kit (CRISPR)
KN414962 1 Kit

KIST (UHMK1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Glycidyl Linoleate
TRC-G615720-50MG 50 mg

Glycidyl Linoleate

Sign In for Pricing
View Details
CLSTN2 (NM_022131) Human Over-expression Lysate
LC402909 20 µg

CLSTN2 (NM_022131) Human Over-expression Lysate

Sign In for Pricing
View Details
MYPT1 Rabbit polyclonal Antibody
ER64090 100 µL

MYPT1 Rabbit polyclonal Antibody

Sign In for Pricing
View Details
RTN4IP1 Human Gene Knockout Kit (CRISPR)
KN402957 1 Kit

RTN4IP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details