Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHI-27, porcine

PHI-27 (porcine) is a 27 amino acid peptide.PHI-27 (porcine) is used to find peptide hormones and other active peptides.

Product Specifications

Purity

≥95%

Molecular Weight

2995.4

Notes

For research use only.

AA Sequence

HADGVFTSDFSRLLGQLSAKKYLESLI-NH2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fetoprotein, Alpha (Alpha-1-fetoprotein, Alpha-fetoglobulin, Alpha-fetoprotein precursor, FETA, HPAFP) (PE) discontinued
F4100-16B-PE 100 µL

Fetoprotein, Alpha (Alpha-1-fetoprotein, Alpha-fetoglobulin, Alpha-fetoprotein precursor, FETA, HPAFP) (PE) discontinued

Sign In for Pricing
View Details
Human Wingless Type MMTV Integration Site Family, Member 7A (WNT7A) ELISA Kit
CK-bio-14002-01 48 Tests

Human Wingless Type MMTV Integration Site Family, Member 7A (WNT7A) ELISA Kit

Sign In for Pricing
View Details
Human Wingless Type MMTV Integration Site Family, Member 7A (WNT7A) ELISA Kit
CK-bio-14002-02 96 Tests

Human Wingless Type MMTV Integration Site Family, Member 7A (WNT7A) ELISA Kit

Sign In for Pricing
View Details
Human Wingless Type MMTV Integration Site Family, Member 7A (WNT7A) ELISA Kit
CK-bio-14002-03 5x 96 Tests

Human Wingless Type MMTV Integration Site Family, Member 7A (WNT7A) ELISA Kit

Sign In for Pricing
View Details
Human Wingless Type MMTV Integration Site Family, Member 7A (WNT7A) ELISA Kit
CK-bio-14002-04 10x 96 Tests

Human Wingless Type MMTV Integration Site Family, Member 7A (WNT7A) ELISA Kit

Sign In for Pricing
View Details
Human SEC14L3 Pre-designed siRNA Set B
SI014446B 1 Each

Human SEC14L3 Pre-designed siRNA Set B

Sign In for Pricing
View Details