Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Parathyroid Hormone (1-38), human

PTH (1-38) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development.

Product Specifications

Field of Research

Metabolism Research

Purity

≥95%

Molecular Weight

4458.2

Notes

For research use only.

AA Sequence

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SOX17 Antibody [mFluor Violet 450 SE]
NBP2-24568MFV450 0.1 mL

Rabbit Polyclonal SOX17 Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Hepcidin-25 Rabbit Polyclonal Antibody (FITC)
orb188318 100 µL

Hepcidin-25 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Recombinant Human HspA9
11118P-1000 1000ug

Recombinant Human HspA9

Sign In for Pricing
View Details
Tert-Butyl 3- (Hydrazinocarbonyl) piperidine-1-carboxylate
JJB15432 5 g

Tert-Butyl 3- (Hydrazinocarbonyl) piperidine-1-carboxylate

Sign In for Pricing
View Details
NDUFV1 (Center) Rabbit pAb
E2619353 100 µL

NDUFV1 (Center) Rabbit pAb

Sign In for Pricing
View Details
Anti-AMHR2 Antibody (Murlentamab-MMAE)
F1914-50 50 mg

Anti-AMHR2 Antibody (Murlentamab-MMAE)

Sign In for Pricing
View Details