Parathyroid Hormone (1-38), human
PTH (1-38) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development.
Product Specifications
Field of Research
Metabolism Research
Purity
≥95%
Molecular Weight
4458.2
Notes
For research use only.
AA Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog