Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Parathyroid Hormone (1-38), human

PTH (1-38) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development.

Product Specifications

Field of Research

Metabolism Research

Purity

≥95%

Molecular Weight

4458.2

Notes

For research use only.

AA Sequence

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SynDIG4 Antibody (L102/71)
MBS1571846-01 0.1 mg

Anti-SynDIG4 Antibody (L102/71)

Sign In for Pricing
View Details
Anti-SynDIG4 Antibody (L102/71)
MBS1571846-02 1 mg

Anti-SynDIG4 Antibody (L102/71)

Sign In for Pricing
View Details
Anti-SynDIG4 Antibody (L102/71)
MBS1571846-03 5x 1 mg

Anti-SynDIG4 Antibody (L102/71)

Sign In for Pricing
View Details
RPIP8 (RUNDC3A) Human Over-expression Lysate
orb1377600 20 µg

RPIP8 (RUNDC3A) Human Over-expression Lysate

Sign In for Pricing
View Details
Ces1a ORF Vector (Mouse) (pORF)
15936014 1.0 µg DNA

Ces1a ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
DMEM with L-alanyl-L-glutamine, HEPES (Low Glucose)
abx704890 500 mL

DMEM with L-alanyl-L-glutamine, HEPES (Low Glucose)

Sign In for Pricing
View Details