Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Parathyroid Hormone (1-38), human

PTH (1-38) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development.

Product Specifications

Field of Research

Metabolism Research

Purity

≥95%

Molecular Weight

4458.2

Notes

For research use only.

AA Sequence

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Donkey B Cell Differentiation Factor ELISA Kit
MBS050716 Inquire

Donkey B Cell Differentiation Factor ELISA Kit

Sign In for Pricing
View Details
5-Amino-2,3,4,5-tetrahydro-benzo[b]azepine-1-carboxylic acid tert-butyl ester
sc-262393A 1 g

5-Amino-2,3,4,5-tetrahydro-benzo[b]azepine-1-carboxylic acid tert-butyl ester

Sign In for Pricing
View Details
Human EPB42 (Erythrocyte Membrane Protein Band 4.2) Microsample ELISA Kit
ELK4982MS-01 48 Tests

Human EPB42 (Erythrocyte Membrane Protein Band 4.2) Microsample ELISA Kit

Sign In for Pricing
View Details
Human EPB42 (Erythrocyte Membrane Protein Band 4.2) Microsample ELISA Kit
ELK4982MS-02 96 Tests

Human EPB42 (Erythrocyte Membrane Protein Band 4.2) Microsample ELISA Kit

Sign In for Pricing
View Details
Human EPB42 (Erythrocyte Membrane Protein Band 4.2) Microsample ELISA Kit
ELK4982MS-03 5x 96 Tests

Human EPB42 (Erythrocyte Membrane Protein Band 4.2) Microsample ELISA Kit

Sign In for Pricing
View Details
ARL11 Mouse Monoclonal Antibody [Clone ID: LBI1A5]
AMM12014V 100 µL

ARL11 Mouse Monoclonal Antibody [Clone ID: LBI1A5]

Sign In for Pricing
View Details