Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Parathyroid Hormone (1-44), human

Parathyroid Hormone (1-44), human

Product Specifications

Field of Research

Metabolism Research

Purity

≥95%

Molecular Weight

5063.93

Notes

For research use only.

AA Sequence

SVSEIELMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HC-056456 2mg
A19487-2 2 mg

HC-056456 2mg

Sign In for Pricing
View Details
Rabbit Polyclonal S1P4/EDG-6 Antibody [DyLight 594]
NBP2-24500DL594 0.1 mL

Rabbit Polyclonal S1P4/EDG-6 Antibody [DyLight 594]

Sign In for Pricing
View Details
SLC38A1 Antibody
29-909 100 µL

SLC38A1 Antibody

Sign In for Pricing
View Details
Bsn ORF Vector (Mouse) (pORF)
13504014 1.0 µg DNA

Bsn ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Tmeff1 (NM_021436) Mouse Tagged ORF Clone Lentiviral Particle
MR205737L4V 200 µL

Tmeff1 (NM_021436) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Di-tert-butyl dicarbonate (DIBOC)
62638603-25g 25 g

Di-tert-butyl dicarbonate (DIBOC)

Sign In for Pricing
View Details