Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Parathyroid Hormone (1-44), human

Parathyroid Hormone (1-44), human

Product Specifications

Field of Research

Metabolism Research

Purity

≥95%

Molecular Weight

5063.93

Notes

For research use only.

AA Sequence

SVSEIELMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyl 3-methylisoxazole-5-carboxylate
BAA00496 5 g

Methyl 3-methylisoxazole-5-carboxylate

Sign In for Pricing
View Details
RIP3 (RIPK3) Mouse Monoclonal Antibody [Clone ID: OTI3A12]
TA803170S 30 µL

RIP3 (RIPK3) Mouse Monoclonal Antibody [Clone ID: OTI3A12]

Sign In for Pricing
View Details
Human Secreted frizzled-related protein 5 ELISA Kit
orb1659955 96 Tests

Human Secreted frizzled-related protein 5 ELISA Kit

Sign In for Pricing
View Details
Lentiviral human DOLPP1 shRNA (UAS) - Lentiviral human DOLPP1 shRNA (UAS) (100)
GTR15135546 1 Vial

Lentiviral human DOLPP1 shRNA (UAS) - Lentiviral human DOLPP1 shRNA (UAS) (100)

Sign In for Pricing
View Details
OGG1 Polyclonal Antibody, FITC Conjugated
bs-3687R-FITC-01 20 µL

OGG1 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
OGG1 Polyclonal Antibody, FITC Conjugated
bs-3687R-FITC-02 100 µL

OGG1 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details