Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Parathyroid Hormone (1-44), human

Parathyroid Hormone (1-44), human

Product Specifications

Field of Research

Metabolism Research

Purity

≥95%

Molecular Weight

5063.93

Notes

For research use only.

AA Sequence

SVSEIELMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUT sgRNA CRISPR Lentivector (Human) (Target 3)
K1369204 1.0 µg DNA

MUT sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Lentiviral human FNDC7 shRNA (UAS) - Lentiviral human FNDC7 shRNA (UAS, iRFP) (100)
GTR15091083 1 Vial

Lentiviral human FNDC7 shRNA (UAS) - Lentiviral human FNDC7 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Human CCDC42B knockout cell line
ABC-KH2537 1 Vial

Human CCDC42B knockout cell line

Sign In for Pricing
View Details
PSMA Rabbit mAb
orb1923553-01 20 ul

PSMA Rabbit mAb

Sign In for Pricing
View Details
PSMA Rabbit mAb
orb1923553-02 50 µL

PSMA Rabbit mAb

Sign In for Pricing
View Details
PSMA Rabbit mAb
orb1923553-03 100 µL

PSMA Rabbit mAb

Sign In for Pricing
View Details