Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuropeptide F

Neuropeptide F

Product Specifications

Purity

≥95%

Molecular Weight

4432

Notes

For research use only.

AA Sequence

PDKDFIVNPSDLVLDNKAALRDYLRQINEYFAIIGRPRF-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Human VAMP1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot,IHC) 200UL
IRBAMLVAMP1AP03200UL 200 µL

Rabbit Anti Human VAMP1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot,IHC) 200UL

Sign In for Pricing
View Details
Rhbdf2 3'UTR Luciferase Stable Cell Line
TU117817 1.0 mL

Rhbdf2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
GENLISA Human C-Mer Proto Oncogene Tyrosine Kinase (MERTK) ELISA
KBH9169 1x 96 Well

GENLISA Human C-Mer Proto Oncogene Tyrosine Kinase (MERTK) ELISA

Sign In for Pricing
View Details
6-Chloro-5-methyl-pyridine-3-sulphonyl chloride
MBA10510-01 0.5 g

6-Chloro-5-methyl-pyridine-3-sulphonyl chloride

Sign In for Pricing
View Details
6-Chloro-5-methyl-pyridine-3-sulphonyl chloride
MBA10510-02 5 g

6-Chloro-5-methyl-pyridine-3-sulphonyl chloride

Sign In for Pricing
View Details
ORAI3 Rabbit Polyclonal Antibody
orb585947 100 µL

ORAI3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details