Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuropeptide F

Neuropeptide F

Product Specifications

Purity

≥95%

Molecular Weight

4432

Notes

For research use only.

AA Sequence

PDKDFIVNPSDLVLDNKAALRDYLRQINEYFAIIGRPRF-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Mdm4 / Protein Mdm4 Recombinant Protein
R12870m 1 Each

Mouse Mdm4 / Protein Mdm4 Recombinant Protein

Sign In for Pricing
View Details
Gm4951 (NM_001033767) Mouse Tagged Lenti ORF Clone
MR213632L4 10 µg

Gm4951 (NM_001033767) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse NUP214 ELISA Kit
EMN0063 96 Tests

Mouse NUP214 ELISA Kit

Sign In for Pricing
View Details
MCH Receptor 1 Antibody
E38QA6709 100 µL

MCH Receptor 1 Antibody

Sign In for Pricing
View Details
OR10A7 Antibody - C-terminal region : HRP (ARP71262_P050-HRP)
ARP71262_P050-HRP 100 µL

OR10A7 Antibody - C-terminal region : HRP (ARP71262_P050-HRP)

Sign In for Pricing
View Details
ACTR8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV791028 1.0 µg DNA

ACTR8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details