Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuropeptide F

Neuropeptide F

Product Specifications

Purity

≥95%

Molecular Weight

4432

Notes

For research use only.

AA Sequence

PDKDFIVNPSDLVLDNKAALRDYLRQINEYFAIIGRPRF-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2U Recombinant Protein (Human)
RP033757 100 µg

UBE2U Recombinant Protein (Human)

Sign In for Pricing
View Details
2310057J18Rik 3'UTR GFP Stable Cell Line
TU150450 1.0 mL

2310057J18Rik 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human UBE2I/UBC9 Protein, His
P1585-.01 10 µg

Recombinant Human UBE2I/UBC9 Protein, His

Sign In for Pricing
View Details
Chicken Nuclear Factor, Interleukin 3 Regulated ELISA Kit
MBS734037-01 48 Well

Chicken Nuclear Factor, Interleukin 3 Regulated ELISA Kit

Sign In for Pricing
View Details
Chicken Nuclear Factor, Interleukin 3 Regulated ELISA Kit
MBS734037-02 96 Well

Chicken Nuclear Factor, Interleukin 3 Regulated ELISA Kit

Sign In for Pricing
View Details
Chicken Nuclear Factor, Interleukin 3 Regulated ELISA Kit
MBS734037-03 5x 96 Well

Chicken Nuclear Factor, Interleukin 3 Regulated ELISA Kit

Sign In for Pricing
View Details