Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuropeptide VF (56-92) (human)

Neuropeptide NPSF is, as the octapeptide NPVF , a partial sequence of the human FMRF amide-related peptides precursor protein. The NPFF-related peptide caused a 50 % reduction in the antinociceptive effects of morphine.

Product Specifications

Purity

≥95%

Molecular Weight

4257.01

Notes

For research use only.

AA Sequence

SLNFEELKDWGPKNVIKMSTPAVNKMPHSFANLPLRF-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human FGF-12/FGF12 Protein
PKSH032433-01 10 µg

Recombinant Human FGF-12/FGF12 Protein

Sign In for Pricing
View Details
Recombinant Human FGF-12/FGF12 Protein
PKSH032433-02 50 µg

Recombinant Human FGF-12/FGF12 Protein

Sign In for Pricing
View Details
CZIB Antibody
KC-32095-01 50 μL

CZIB Antibody

Sign In for Pricing
View Details
CZIB Antibody
KC-32095-02 100 µL

CZIB Antibody

Sign In for Pricing
View Details
CZIB Antibody
KC-32095-03 1 mL

CZIB Antibody

Sign In for Pricing
View Details
Human RIOK2 activation kit by CRISPRa
GA110964 1 Kit

Human RIOK2 activation kit by CRISPRa

Sign In for Pricing
View Details