Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuropeptide VF (56-92) (human)

Neuropeptide NPSF is, as the octapeptide NPVF , a partial sequence of the human FMRF amide-related peptides precursor protein. The NPFF-related peptide caused a 50 % reduction in the antinociceptive effects of morphine.

Product Specifications

Purity

≥95%

Molecular Weight

4257.01

Notes

For research use only.

AA Sequence

SLNFEELKDWGPKNVIKMSTPAVNKMPHSFANLPLRF-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS635398 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
b-Nicotinamide Adenine Dinucleotide Sodium Salt Hydrate
TRC-N407775-1G 1 g

b-Nicotinamide Adenine Dinucleotide Sodium Salt Hydrate

Sign In for Pricing
View Details
RBM15B Human Gene Knockout Kit (CRISPR)
KN422622 1 Kit

RBM15B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2955), CF740 conjugate, 0.1mg/mL
BNC742955-500 1x 500 µL

C1QA / Complement C1q A-Chain (C1QA/2955), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PDE3B (NM_000922) Human Over-expression Lysate
LC424435 20 µg

PDE3B (NM_000922) Human Over-expression Lysate

Sign In for Pricing
View Details
Tiafenacil
TRC-T436300-1MG 1 mg

Tiafenacil

Sign In for Pricing
View Details