Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuropeptide VF (56-92) (human)

Neuropeptide NPSF is, as the octapeptide NPVF , a partial sequence of the human FMRF amide-related peptides precursor protein. The NPFF-related peptide caused a 50 % reduction in the antinociceptive effects of morphine.

Product Specifications

Purity

≥95%

Molecular Weight

4257.01

Notes

For research use only.

AA Sequence

SLNFEELKDWGPKNVIKMSTPAVNKMPHSFANLPLRF-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Interleukin-3/IL-3 Protein (His Tag)
PKSM041089-01 10 µg

Recombinant Mouse Interleukin-3/IL-3 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-3/IL-3 Protein (His Tag)
PKSM041089-02 50 µg

Recombinant Mouse Interleukin-3/IL-3 Protein (His Tag)

Sign In for Pricing
View Details
5Alpha,6Beta-Dibromostigmastan-3Beta-yl 3-Acetate
TRC-D426015-50MG 50 mg

5Alpha,6Beta-Dibromostigmastan-3Beta-yl 3-Acetate

Sign In for Pricing
View Details
Human VEGF-D Antibody Pair Set
E-KAB-0227 50 µL & 100 µg

Human VEGF-D Antibody Pair Set

Sign In for Pricing
View Details
Porcine IgG (Immunoglobulin G) ELISA Kit
E-EL-P0004-01 24 Tests

Porcine IgG (Immunoglobulin G) ELISA Kit

Sign In for Pricing
View Details
Porcine IgG (Immunoglobulin G) ELISA Kit
E-EL-P0004-02 48 Tests

Porcine IgG (Immunoglobulin G) ELISA Kit

Sign In for Pricing
View Details