Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuropeptide VF (56-92) (human)

Neuropeptide NPSF is, as the octapeptide NPVF , a partial sequence of the human FMRF amide-related peptides precursor protein. The NPFF-related peptide caused a 50 % reduction in the antinociceptive effects of morphine.

Product Specifications

Purity

≥95%

Molecular Weight

4257.01

Notes

For research use only.

AA Sequence

SLNFEELKDWGPKNVIKMSTPAVNKMPHSFANLPLRF-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COG2 Rabbit Polyclonal Antibody
TA374949 100 µL

COG2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tolyltriazole
TRC-T537000-5G 5 g

Tolyltriazole

Sign In for Pricing
View Details
NEB Antibody
KC-7408-01 50 μL

NEB Antibody

Sign In for Pricing
View Details
NEB Antibody
KC-7408-02 100 µL

NEB Antibody

Sign In for Pricing
View Details
NEB Antibody
KC-7408-03 1 mL

NEB Antibody

Sign In for Pricing
View Details
MAGE A1 (MZ2E/838), CF647 conjugate, 0.1mg/mL
BNC470838-100 1x 100 µL

MAGE A1 (MZ2E/838), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details