Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuropeptide VF (56-92) (human)

Neuropeptide NPSF is, as the octapeptide NPVF , a partial sequence of the human FMRF amide-related peptides precursor protein. The NPFF-related peptide caused a 50 % reduction in the antinociceptive effects of morphine.

Product Specifications

Purity

≥95%

Molecular Weight

4257.01

Notes

For research use only.

AA Sequence

SLNFEELKDWGPKNVIKMSTPAVNKMPHSFANLPLRF-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Sh3bgr activation kit by CRISPRa
GA205374 1 Kit

Mouse Sh3bgr activation kit by CRISPRa

Sign In for Pricing
View Details
HTRA1 (C-term) Rabbit Polyclonal Antibody
AP11327PU-N 400 µL

HTRA1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
XFD350 tyramide reagent
11067-AAT 200 Slides

XFD350 tyramide reagent

Sign In for Pricing
View Details
Human 5T4 (TPBG) activation kit by CRISPRa
GA104946 1 Kit

Human 5T4 (TPBG) activation kit by CRISPRa

Sign In for Pricing
View Details
CD70 Mouse Monoclonal Antibody [Clone ID: OTI5D8]
CF813221 100 µg

CD70 Mouse Monoclonal Antibody [Clone ID: OTI5D8]

Sign In for Pricing
View Details
FNTB (NM_002028) Human Recombinant Protein
TP305858M 100 µg

FNTB (NM_002028) Human Recombinant Protein

Sign In for Pricing
View Details