Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Peptide YY (3-36), PYY, human

Peptide YY (PYY) (3-36), porcine is a gut hormone peptide that acts as a Y2 receptor agonist to reduce appetite.

Product Specifications

Purity

≥95%

Molecular Weight

4049.55

Notes

For research use only.

AA Sequence

AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FURIN Polyclonal Antibody
E55A00537 100 µg

FURIN Polyclonal Antibody

Sign In for Pricing
View Details
Human ATP6V1H Knockout A549 cell line
GTR15422205 1 Vial

Human ATP6V1H Knockout A549 cell line

Sign In for Pricing
View Details
ALDOB, NT (ALDOB, ALDB, Fructose-bisphosphate aldolase B, Liver-type aldolase) (PE)
MBS6272849-01 0.2 mL

ALDOB, NT (ALDOB, ALDB, Fructose-bisphosphate aldolase B, Liver-type aldolase) (PE)

Sign In for Pricing
View Details
ALDOB, NT (ALDOB, ALDB, Fructose-bisphosphate aldolase B, Liver-type aldolase) (PE)
MBS6272849-02 5x 0.2 mL

ALDOB, NT (ALDOB, ALDB, Fructose-bisphosphate aldolase B, Liver-type aldolase) (PE)

Sign In for Pricing
View Details
MDH1B (NM_001039845) Human Recombinant Protein
TP310625 20 µg

MDH1B (NM_001039845) Human Recombinant Protein

Sign In for Pricing
View Details
4930524E20Rik-set siRNA/shRNA/RNAi Lentivector (Mouse)
10658094 4x 500 ng

4930524E20Rik-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details