Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Peptide YY (3-36), PYY, human

Peptide YY (PYY) (3-36), porcine is a gut hormone peptide that acts as a Y2 receptor agonist to reduce appetite.

Product Specifications

Purity

≥95%

Molecular Weight

4049.55

Notes

For research use only.

AA Sequence

AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIF sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0008906 1.0 µg DNA

LIF sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Recombinant Hepatitis B virus genotype C subtype ayw Large envelope protein (S), partial
MBS7097580 Inquire

Recombinant Hepatitis B virus genotype C subtype ayw Large envelope protein (S), partial

Sign In for Pricing
View Details
YDJC, ID (YDJC, UPF0249 protein ydjC homolog) (MaxLight 490)
MBS6364210-01 0.1 mL

YDJC, ID (YDJC, UPF0249 protein ydjC homolog) (MaxLight 490)

Sign In for Pricing
View Details
YDJC, ID (YDJC, UPF0249 protein ydjC homolog) (MaxLight 490)
MBS6364210-02 5x 0.1 mL

YDJC, ID (YDJC, UPF0249 protein ydjC homolog) (MaxLight 490)

Sign In for Pricing
View Details
Relaxin Receptor 3 (h) -PR
sc-60717-PR 10 µM - 20 µL

Relaxin Receptor 3 (h) -PR

Sign In for Pricing
View Details
WDR68 (DCAF7, AN11, HAN11, SWAN-1, WD repeat-containing protein 68, WD repeat-containing protein An11 homolog, DDB1-and CUL4-associated Factor 7) (MaxLight 490)
MBS6450227-01 0.1 mL

WDR68 (DCAF7, AN11, HAN11, SWAN-1, WD repeat-containing protein 68, WD repeat-containing protein An11 homolog, DDB1-and CUL4-associated Factor 7) (MaxLight 490)

Sign In for Pricing
View Details