Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calcitonin, eel

Calcitonin, eel is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis.

Product Specifications

Purity

≥95%

Molecular Weight

3414.94

Notes

For research use only.

AA Sequence

CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 (Disulfide bridge: Cys1-Cys7)

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tram1 Pre-designed siRNA Set B
SI115164B 1 Each

Mouse Tram1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
SARS-CoV-2 ORF6 Positive Control
MBS5401323 Inquire

SARS-CoV-2 ORF6 Positive Control

Sign In for Pricing
View Details
DAP12 (TYROBP) (NM_001173515) Human Tagged ORF Clone
RG229529 10 µg

DAP12 (TYROBP) (NM_001173515) Human Tagged ORF Clone

Sign In for Pricing
View Details
RBM4 CRISPR Activation Plasmid (h2)
sc-403993-ACT-2 20 µg

RBM4 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Esyt1 3'UTR Luciferase Stable Cell Line
TU204117 1.0 mL

Esyt1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
MX1 antibody
70R-18688 50 μL

MX1 antibody

Sign In for Pricing
View Details