Calcitonin, eel
Calcitonin, eel is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis.
Product Specifications
Purity
≥95%
Molecular Weight
3414.94
Notes
For research use only.
AA Sequence
CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 (Disulfide bridge: Cys1-Cys7)
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
128369-ML405 100 µL
IKK alpha (Inhibitor Of Nuclear Factor kappa-B Kinase alpha Subunit, I kappa-B Kinase alpha, IkBKA, IKK-A, IkappaB Kinase, I-kappa-B Kinase 1, IKK1, Conserved Helix-loop-Helix Ubiquitous Kinase, Nuclear Factor NFkappaB Inhibitor Kinase alpha, NFKBIKA, Transcription Factor 16, TCF-16, CHUK, IKKA, TCF16) (MaxLight 405) discontinued
Sign In for Pricing
View Details 
MBS6420377-01 0.1 mL
HIP1R (Huntingtin-interacting Protein 1-related Protein, HIP3, HIP12, ILWEQ) (MaxLight 650)
Sign In for Pricing
View Details MBS6420377-02 5x 0.1 mL
HIP1R (Huntingtin-interacting Protein 1-related Protein, HIP3, HIP12, ILWEQ) (MaxLight 650)
Sign In for Pricing
View Details