Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calcitonin, eel

Calcitonin, eel is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis.

Product Specifications

Purity

≥95%

Molecular Weight

3414.94

Notes

For research use only.

AA Sequence

CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 (Disulfide bridge: Cys1-Cys7)

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR6C4 (NM_001005494) Human Tagged ORF Clone Lentiviral Particle
RC221921L3V 200 µL

OR6C4 (NM_001005494) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SLC10A1
CSB-CL623947HU 10 μg Plasmid + 200 μL Glycerol

SLC10A1

Sign In for Pricing
View Details
CDK5 monoclonal antibody
MB67064-01 50 µL

CDK5 monoclonal antibody

Sign In for Pricing
View Details
CDK5 monoclonal antibody
MB67064-02 100 µL

CDK5 monoclonal antibody

Sign In for Pricing
View Details
Thyroperoxidase Rabbit Polyclonal Antibody
JOT-AP05104-01 50ul

Thyroperoxidase Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Thyroperoxidase Rabbit Polyclonal Antibody
JOT-AP05104-02 100ul

Thyroperoxidase Rabbit Polyclonal Antibody

Sign In for Pricing
View Details