Calcitonin, eel
Calcitonin, eel is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis.
Product Specifications
Purity
≥95%
Molecular Weight
3414.94
Notes
For research use only.
AA Sequence
CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 (Disulfide bridge: Cys1-Cys7)
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9014549 Inquire
Rabbit anti-Drosophila melanogaster (Fruit fly) SLU7 Polyclonal Antibody
Sign In for Pricing
View Details 
MBS6135590-01 0.1 mL
C4B (Complement C4-B, Basic Complement C4, C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 3, CO4, CPAMD3) APC
Sign In for Pricing
View Details MBS6135590-02 5x 0.1 mL
C4B (Complement C4-B, Basic Complement C4, C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 3, CO4, CPAMD3) APC
Sign In for Pricing
View Details 
NBP2-15264 0.1 mL
Rabbit Polyclonal actin-related protein 2/3 complex subunit 1B Antibody
Sign In for Pricing
View Details