Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calcitonin, rat

Calcitonin, rat

Product Specifications

Purity

≥95%

Molecular Weight

3399.9

Notes

For research use only.

AA Sequence

CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP-NH2 (Disulfide bridge:Cys1-Cys7)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCGN Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-11754R-BF680-01 20 µL

SCGN Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
SCGN Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-11754R-BF680-02 100 µL

SCGN Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
BIOTIN*Polyclonal   Goat Anti- Human Ig
C030850-10ml 10ml

BIOTIN*Polyclonal Goat Anti- Human Ig

Sign In for Pricing
View Details
LOC317456 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6002603 1.0 µg DNA

LOC317456 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Mouse Cdh17 activation kit by CRISPRa
GA200661 1 Kit

Mouse Cdh17 activation kit by CRISPRa

Sign In for Pricing
View Details
FITC anti-mouse H-2Kd
GT02397 500 µg

FITC anti-mouse H-2Kd

Sign In for Pricing
View Details