Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calcitonin, rat

Calcitonin, rat

Product Specifications

Purity

≥95%

Molecular Weight

3399.9

Notes

For research use only.

AA Sequence

CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP-NH2 (Disulfide bridge:Cys1-Cys7)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bacillus anthracis Regulatory protein spx 2 (spxA2)
MBS1361567-01 0.02 mg (E-Coli)

Recombinant Bacillus anthracis Regulatory protein spx 2 (spxA2)

Sign In for Pricing
View Details
Recombinant Bacillus anthracis Regulatory protein spx 2 (spxA2)
MBS1361567-02 0.1 mg (E-Coli)

Recombinant Bacillus anthracis Regulatory protein spx 2 (spxA2)

Sign In for Pricing
View Details
Recombinant Bacillus anthracis Regulatory protein spx 2 (spxA2)
MBS1361567-03 0.02 mg (Yeast)

Recombinant Bacillus anthracis Regulatory protein spx 2 (spxA2)

Sign In for Pricing
View Details
Recombinant Bacillus anthracis Regulatory protein spx 2 (spxA2)
MBS1361567-04 0.1 mg (Yeast)

Recombinant Bacillus anthracis Regulatory protein spx 2 (spxA2)

Sign In for Pricing
View Details
Recombinant Bacillus anthracis Regulatory protein spx 2 (spxA2)
MBS1361567-05 0.02 mg (Baculovirus)

Recombinant Bacillus anthracis Regulatory protein spx 2 (spxA2)

Sign In for Pricing
View Details
Recombinant Bacillus anthracis Regulatory protein spx 2 (spxA2)
MBS1361567-06 0.02 mg (Mammalian-Cell)

Recombinant Bacillus anthracis Regulatory protein spx 2 (spxA2)

Sign In for Pricing
View Details