Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prolactin Releasing Peptide (1-31), bovine

Prolactin-Releasing Peptide (1-31), bovine is a fragment of the prolactin releasing peptide (PrRP) .

Product Specifications

Purity

≥95%

Molecular Weight

3576.07

Notes

For research use only.

AA Sequence

SRAHQHSMEIRTPDINPAWYAGRGIRPVGRF-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (NKI-beteb), CF594 conjugate, 0.1mg/mL
BNC940226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF647 conjugate, 0.1mg/mL
BNC470193-500 1x 500 µL

CD86 (BU63), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL
BNC942216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF647 conjugate, 0.1mg/mL
BNC470175-100 1x 100 µL

CD46 (122.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL
BNC680158-500 1x 500 µL

Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL
BNC740676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details