Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LEAP-2 (38 - 77) (Human)

The native and reduced forms of LEAP-2 have similar antimicrobial activities which suggests that the disulfide bridges are not essential for activity.

Product Specifications

Field of Research

Immunology & Inflammation

Purity

≥95%

Molecular Weight

4585.36

Notes

For research use only.

AA Sequence

MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSC2, Phosphorylated (S1343) (Tsc2, Tuberin, Tuberous sclerosis 2 protein homolog) (MaxLight 650)
MBS6359317-01 0.1 mL

TSC2, Phosphorylated (S1343) (Tsc2, Tuberin, Tuberous sclerosis 2 protein homolog) (MaxLight 650)

Sign In for Pricing
View Details
TSC2, Phosphorylated (S1343) (Tsc2, Tuberin, Tuberous sclerosis 2 protein homolog) (MaxLight 650)
MBS6359317-02 5x 0.1 mL

TSC2, Phosphorylated (S1343) (Tsc2, Tuberin, Tuberous sclerosis 2 protein homolog) (MaxLight 650)

Sign In for Pricing
View Details
Human Neutrophil Gelatinase-Associated Lipocalin, LCN2 ELISA Kit
BPE051-01 96 Tests

Human Neutrophil Gelatinase-Associated Lipocalin, LCN2 ELISA Kit

Sign In for Pricing
View Details
Human Neutrophil Gelatinase-Associated Lipocalin, LCN2 ELISA Kit
BPE051-02 5x 96 Tests

Human Neutrophil Gelatinase-Associated Lipocalin, LCN2 ELISA Kit

Sign In for Pricing
View Details
Human Neutrophil Gelatinase-Associated Lipocalin, LCN2 ELISA Kit
BPE051-03 15 x 96 Tests

Human Neutrophil Gelatinase-Associated Lipocalin, LCN2 ELISA Kit

Sign In for Pricing
View Details
ABCG8 Rabbit pAb, AE conjugated
orb2866977 100 µL

ABCG8 Rabbit pAb, AE conjugated

Sign In for Pricing
View Details