Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C-Type Natriuretic Peptide (1-53) (human)

C-Type Natriuretic Peptide (1-53), human is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone.

Product Specifications

Field of Research

Cardiovascular Research

Purity

≥95%

Molecular Weight

5801.81

Notes

For research use only.

AA Sequence

DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge:Cys37-Cys55)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1683), CF405S conjugate, 0.1mg/mL
BNC041683-500 1x 500 µL

Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1683), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX17 Human Gene Knockout Kit (CRISPR)
KN220888BN 1 Kit

SOX17 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CDHR4 Rabbit Polyclonal Antibody
TA367967 100 µL

CDHR4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Maackia amurensis Gel -MAA- Immobilized Lectin
AK-7801-1 1 mL/Kit

Maackia amurensis Gel -MAA- Immobilized Lectin

Sign In for Pricing
View Details
Plexin D1 (PLXND1) Human Gene Knockout Kit (CRISPR)
KN216518BN 1 Kit

Plexin D1 (PLXND1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
rac Styrene Oxide
TRC-S687795-50G 50 g

rac Styrene Oxide

Sign In for Pricing
View Details