Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C-Type Natriuretic Peptide (1-53) (human)

C-Type Natriuretic Peptide (1-53), human is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone.

Product Specifications

Field of Research

Cardiovascular Research

Purity

≥95%

Molecular Weight

5801.81

Notes

For research use only.

AA Sequence

DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge:Cys37-Cys55)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(R)-Benzyl 2-(((S)-5-Oxooctan-4-yl)amino)propanoate
TRC-B900490-50MG 50 mg

(R)-Benzyl 2-(((S)-5-Oxooctan-4-yl)amino)propanoate

Sign In for Pricing
View Details
GIPC3 Antibody
KC-43629-01 50 μL

GIPC3 Antibody

Sign In for Pricing
View Details
GIPC3 Antibody
KC-43629-02 100 µL

GIPC3 Antibody

Sign In for Pricing
View Details
GIPC3 Antibody
KC-43629-03 1 mL

GIPC3 Antibody

Sign In for Pricing
View Details
rac N’-Nitrosonornicotine 5’-Acetate (Mixture of Diastereomers)
TRC-N534995-5MG 5 mg

rac N’-Nitrosonornicotine 5’-Acetate (Mixture of Diastereomers)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Succinyl Canavalia ensiformis Lectin (Jackbean) -Succinyl Con A-, 1mL 30nm
GP-1102-30 1 mL

Colloidal Gold Conjugated Succinyl Canavalia ensiformis Lectin (Jackbean) -Succinyl Con A-, 1mL 30nm

Sign In for Pricing
View Details