Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C-Type Natriuretic Peptide (1-53) (human)

C-Type Natriuretic Peptide (1-53), human is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone.

Product Specifications

Field of Research

Cardiovascular Research

Purity

≥95%

Molecular Weight

5801.81

Notes

For research use only.

AA Sequence

DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge:Cys37-Cys55)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

0610007C21Rik (BC049637) Mouse Tagged ORF Clone
MG201282 10 µg

0610007C21Rik (BC049637) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
TLE4 Rabbit Polyclonal Antibody
AP06714PU-N 100 µg

TLE4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-(4,5-Dihydro-1h-imidazol-2-yl)pyridine
TRC-D177851-500MG 500 mg

2-(4,5-Dihydro-1h-imidazol-2-yl)pyridine

Sign In for Pricing
View Details
CD13 Antibody
KC-984-01 50 μL

CD13 Antibody

Sign In for Pricing
View Details
CD13 Antibody
KC-984-02 100 µL

CD13 Antibody

Sign In for Pricing
View Details
CD13 Antibody
KC-984-03 1 mL

CD13 Antibody

Sign In for Pricing
View Details