Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C-Type Natriuretic Peptide (1-53) (human)

C-Type Natriuretic Peptide (1-53), human is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone.

Product Specifications

Field of Research

Cardiovascular Research

Purity

≥95%

Molecular Weight

5801.81

Notes

For research use only.

AA Sequence

DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge:Cys37-Cys55)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1475), 0.2mg/mL
BNUB1475-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1475), 0.2mg/mL

Sign In for Pricing
View Details
IKBKG Antibody
KC-1303-01 50 μL

IKBKG Antibody

Sign In for Pricing
View Details
IKBKG Antibody
KC-1303-02 100 µL

IKBKG Antibody

Sign In for Pricing
View Details
IKBKG Antibody
KC-1303-03 1 mL

IKBKG Antibody

Sign In for Pricing
View Details
AIFM3 Rabbit Polyclonal Antibody
TA373379 100 µL

AIFM3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Human CD11c Antibody[BU15]
E-AB-F1118I-01 20 Tests

PE/Cyanine5.5 Anti-Human CD11c Antibody[BU15]

Sign In for Pricing
View Details